PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10014683m
Common NameEUTSA_v10014683mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family MIKC_MADS
Protein Properties Length: 209aa    MW: 24174.1 Da    PI: 9.5056
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10014683mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF79.91.7e-25958150
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                     krien  nr vtfskRrng+ KKA+E+ vLCda+va+iif+s+gk+ +y+
  Thhalv10014683m  9 KRIENANNRVVTFSKRRNGLVKKAKEITVLCDAKVALIIFASNGKMTDYC 58
                     79*********************************************997 PP

2K-box82.68.7e-2871169199
            K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaL 94 
                      yqk sgk+l++ak+e+l++e++++kke+++Lq e+Rhl+Ged++sL+lk+L+ +e+++e++l k+R++++e+l+++ ++ +++ +e+++ n +L
  Thhalv10014683m  71 YQKLSGKKLWDAKHENLSNEIDRIKKENDSLQLELRHLKGEDIQSLNLKNLMAVEHAIEHGLDKVREHQMEFLMTKRRNEKMMVEENRQLNFQL 164
                      899******************************************************************************************* PP

            K-box  95 rkkle 99 
                      +++ +
  Thhalv10014683m 165 QQQEM 169
                      *9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.375161IPR002100Transcription factor, MADS-box
SMARTSM004326.6E-38160IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.11E-34296IPR002100Transcription factor, MADS-box
CDDcd002657.89E-38280No hitNo description
PRINTSPR004044.7E-26323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003197.7E-221057IPR002100Transcription factor, MADS-box
PRINTSPR004044.7E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004044.7E-263859IPR002100Transcription factor, MADS-box
PfamPF014865.8E-1782164IPR002487Transcription factor, K-box
PROSITE profilePS5129714.04184170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MGRGKIEIKR IENANNRVVT FSKRRNGLVK KAKEITVLCD AKVALIIFAS NGKMTDYCCP  60
SMDFGAMLDQ YQKLSGKKLW DAKHENLSNE IDRIKKENDS LQLELRHLKG EDIQSLNLKN  120
LMAVEHAIEH GLDKVREHQM EFLMTKRRNE KMMVEENRQL NFQLQQQEMA IASNARGMMM  180
RDHDAQFGFR VQPIQPNLQE KIMSLVID*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A1e-15263162MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B1e-15263162MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C1e-15263162MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D1e-15263162MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00080ChIP-seqTransfer from AT5G20240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9679630.0KC967963.1 Brassica oleracea var. viridis PI.c (PI.c) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006400591.11e-154hypothetical protein EUTSA_v10014683mg
SwissprotP480071e-148PIST_ARATH; Floral homeotic protein PISTILLATA
TrEMBLV4LED81e-154V4LED8_EUTSA; Uncharacterized protein
STRINGAT5G20240.11e-145(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53002751
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.11e-149MIKC_MADS family protein